PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01311.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 821aa    MW: 88571 Da    PI: 8.9456
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01311.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-171461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT+eEd+ lv +v+++G+g+W++++   g+ R+ k+c++rw +yl
  Zmw_sc01311.1.g00080.1.am.mk 14 KGPWTPEEDLMLVSYVQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                                  79********************************************97 PP

2Myb_DNA-binding47.15.7e-1567112148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg++T +E++l++++  +lG++ W++Ia++++  Rt++++k++w+++l
  Zmw_sc01311.1.g00080.1.am.mk  67 RGNFTDQEEKLIIHLQVLLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                                   89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.935965IPR017930Myb domain
SuperFamilySSF466891.91E-2911108IPR009057Homeodomain-like
SMARTSM007177.5E-141363IPR001005SANT/Myb domain
PfamPF002494.6E-161461IPR001005SANT/Myb domain
CDDcd001672.21E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2365117IPR009057Homeodomain-like
PROSITE profilePS5129419.83166116IPR017930Myb domain
SMARTSM007171.3E-1566114IPR001005SANT/Myb domain
PfamPF002498.9E-1467112IPR001005SANT/Myb domain
CDDcd001678.26E-1169112No hitNo description
ProDomPD1257747.0E-24732811IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.8E-27752804IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.9E-20753802IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.361754803IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDLMLVSYVQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIIH LQVLLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMQ  120
AGESGGGDQD GVRVSESAGA GDRVGGEKRP TVHKGQWERR LQTDIHTARQ ALREALSLEP  180
SPPAKMAPLP TPAGSATYAS SAENIARLLE GWLRPGSGCG KGPETSGSTF TTGTTQQRPQ  240
CSGEGAASAS ESHSGGTAAM AVQTPECSTE TSKMVGAAGA GAPPAFSMLE NWLLDDGMAH  300
GEVGLIDVVP LGDPSMARCT GAGQWDCHGD ACMFLLLLHG YARVKQSQPQ EKIGKEKSES  360
KEQRNKRPGR PGRAECNAMR PWKRTGTGFN AGSVGCRFCR APLSFSPCLL SPACSQEDSG  420
RPSPGRHCPP APCIMQACGG TPNLIQSSWQ AEELRVMGLN AEQKGHRRGV NARPTHDPAR  480
QLRPYTVYSY YSAASEESRA GSSFIIQFSA LLCLFSFTMN VNVRLGGSNG LRNVCVRASG  540
RRGKEGRTHA VEGQWRVPSA HLVGGLNAPA LPAPSLIDLK ALSPLITAAP LRSRNGMELN  600
GPSEADPGDG IRRRRDGETS APPTDKRART YCCRPAGSVR SIDRNSRGAV GVRSGTVRSI  660
LSDRIEAIGA RYERPAVASP TRRISPVSHD DVGGGGGDSY LPVVHSEQGL HSPCAETRLW  720
LAGWEEEGKL TMKRLLILRR CEPIVRFTCC SVRYGECRRN HAATTGGYSV DGCREFIAEG  780
EEGTGGALKC AACGCHRSFH RRVQVYEVSW DYAASDSSST E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-25141164105C-Myb DNA-Binding Domain
1mse_C2e-25141164105C-Myb DNA-Binding Domain
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296